Osteocalcin, Recombinant, Chicken, aa49-97, His-KSI-Tag

Size

£633.00

SKU:: 585651
Molecular Weight:: 20.7
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa49-97 from chicken Osteocalcin, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.7kD Amino Acid Sequence: HYAQDSGVAGAPPNPLEAQREVCELSPDCDELADQIGFQEAYRRFYGPV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.