Hemolysin E, Chromosomal, Recombinant, E. coli, aa2-182, His-Tag

Size

£633.00

SKU:: 584821
Molecular Weight:: 21.2
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 20mm Tris-HCl, pH 8.0, 0.5M sodium chloride, 50% glycerol.
Extra Details:: Toxin, which has some hemolytic activity towards mammalian cells. Acts by forming a pore-like structure upon contact with mammalian cells. Recombinant protein corresponding to aa2-182 from Escherichia coli Hemolysin E, chromosomal, fused to 6X His-Tag at C-terminal, expressed in E. coli. Accession: P77335 Molecular Weight: ~21.2kD Amino Acid Sequence: TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.