584673
Glucagon-like Peptide 1 Receptor, Recombinant, Rat, aa22-135, His-Tag
Size
£626.00
- SKU:
- 584673
- Molecular Weight:
- 15.6
- Purity:
- ≥85% (SDS-PAGE)
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Extra Details:
- G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Partial recombinant protein corresponding to aa22-135 from rat Glucagon-like peptide 1 receptor, fused to 10X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~15.6kD Amino Acid Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice