Gastric Inhibitory Polypeptide Receptor, Recombinant, Human, aa22-138, MBP-Tag, His-Avi-Tag (Biotin)

Size

£703.00

SKU:: 584637
Molecular Weight:: 61.2
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml. Labeled with Biotin.
Extra Details:: This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Partial recombinant protein corresponding to aa22-138 from human Gastric inhibitory polypeptide receptor, fused to MBP-Tag at N-terminal and 6X His-Avi-Tag at C-terminal, expressed in E.coli. Swiss/Uniprot: P48546 Molecular Weight: ~61.2kD Amino Acid Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.