Erythropoietin Receptor, Recombinant, Rat, aa25-249, His-Tag

Size

£633.00

SKU:: 584452
Molecular Weight:: 25.7
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate LYN tyrosine kinase (By similarity). Source: Recombinant protein corresponding to aa25-249 from rat Erythropoietin receptor, fused to 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~25.7kD Amino Acid Sequence: ASSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.