Cyanovirin-N Homolog, Recombinant, Ceratopteris richardii, aa28-142

Size

£673.00

SKU:: 584114
Molecular Weight:: 12.4
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris, 50% glycerol
Extra Details:: Mannose-binding lectin. Source: Recombinant protein corresponding to aa28-142 from Ceratopteris richardii Cyanovirin-N homolog, expressed in Yeast. Molecular Weight: ~12.4kD Amino Acid Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.