Collagen Alpha-1(XI) Chain, Recombinant, Human, aa532-699, GST-Tag, partial

Size

£524.00

SKU:: 584039
Molecular Weight:: 42.8
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils. Source: Recombinant protein corresponding to aa532-699 from human Collagen alpha-1(XI) chain, fused to GST-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.8kD Amino Acid Sequence: GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.