Claudin-6, Recombinant, Human, aa1-82, His-SUMO-Tag

Size

£849.00

SKU:: 584016
Molecular Weight:: 24.8
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 20mM Tris-HCl, 0.15M sodium chloride, 0.05% Brij-78, pH 8.0, 50% glycerol.
Extra Details:: Plays a major role in tight junction-specific obliteration of the intercellular space. Source: Partial recombinant protein corresponding to aa1-82 from human Claudin-6, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Swiss/UniProt Accession: P56747. Molecular Weight: ~24.8kD Amino Acid Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.