583709
ATP-dependent (S)-NAD(P)H-hydRate DehydRatase, Recombinant, Caenorhabditis elegans, aa1-307, His-Tag
Size
£598.00
- SKU:
- 583709
- Molecular Weight:
- 35.9
- Purity:
- ≥90% (SDS-PAGE)
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Extra Details:
- Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. Source: Recombinant protein corresponding to aa1-307 from Caenorhabditis elegans ATP-dependent (S)-NAD(P)H-hydRate dehydRatase, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~35.9kD Amino Acid Sequence: MDHFIKLLPKLTPHLRKGDCGKMGVIGGSLEYTGAPYFAASSASRLGADLIHIFCDPDAAQVIKGYSPDLIVHPGMTANSIIPKLSRMDAIVIGPGLGRNPNIWPLMQELFEFVRNRDVPFVIDGDGLWFVSEHIEKFPRQMSATVLTPNIVEFSRLCKSALGEEDVLNVRNNSQLQHLAAELSRKMNVTIYLKGEVDLVVTPNGEVSKCSTESSLRRCGGQGDVTAGSLGLFLYWAKKNLGDDWTSAHHEAGIASSWLVRTAGRRAFEKHGRSMNTPLLLDEIPKLVRDVETREMKDTVHTDSSKH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice