Antigenic Integral Membrane Glycoprotein, Recombinant, Schistosoma mansoni, aa69-160, His-Trx-Tag

Size

£633.00

SKU:: 583636
Molecular Weight:: 28.9
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris, pH 8.0, 50% glycerol
Extra Details:: Major antigen in the surface tegument. Source: Recombinant protein corresponding to aa69-160 from Schistosoma mansoni Antigenic integral membrane glycoprotein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.9kD Amino Acid Sequence: VNSEENSNSIITDEDYDHYNSSLDSSNNVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSANKYMK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.