Alpha-2-macroglobulin Receptor-associated Protein, Recombinant, Mouse, aa248-360, GFP-Tag, His-Tag

Size

£626.00

SKU:: 583567
Molecular Weight:: 42.3
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway. Source: Recombinant protein corresponding to aa248-360 from mouse Alpha-2-macroglobulin receptor-associated protein, fused to GFP-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~42.3kD Amino Acid Sequence: GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.