YAP1

Size

£843.00

SKU:: 551802
Purity:: Purified by affinity chromatography from cell culture.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa53-161 from human YAP1, fused to GST-Tag. MW of the GST-Tag alone is 26kD. Species sequence homology: mouse
Clone:: 2F12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [provided by RefSeq]. Applications: Suitable for use in ELISA, Immunoflourescence, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry: paraffin Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.