GABBR1

Size

£843.00

SKU:: 551679
Purity:: Purified by affinity chromatography from cell culture.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa52-151 from human GABBR1, fused to GST-Tag. MW of the GST-Tag alone is 26kD. Species sequence homology: mouse and rat
Clone:: 2D7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. GABA exerts its effects through ionotropic [GABA(A/C)] receptors, to produce fast synaptic inhibition, and metabotropic [GABA(B)] receptors, to produce slow, prolonged inhibitory signals. The GABA(B) receptor consists of a heterodimer of two related 7-transmembrane receptors, GABA(B) receptor 1 and GABA(B) receptor 2. The GABA(B) receptor 1 gene is mapped to chromosome 6p21.3 within the HLA class I region close to the HLA-F gene. Susceptibility loci for multiple sclerosis, epilepsy, and schizophrenia have also been mapped in this region. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq]. Applications: Suitable for use in ELISA, Immunofluorescence, and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGF LFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYN FTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHY DVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYE NVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLE RDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVIL YSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNG AGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYD AQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF STQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGG HRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRP RRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYI NADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGF EGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFF QRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELV EKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRD YAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVK NFTEIASKFSERLQDFDKSKHVIYAPSSHNKYAGESFP GIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAE TLSEVA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice