551671
FLOT2
Size
£685.00
- SKU:
- 551671
- Application:
- WB
- Purity:
- Ascites
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length protein corresponding to aa1-379 from human FLOT2.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq]. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVA CEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQ DRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDY LSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKE MLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQ LAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILR TDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAE AEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGD AAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVT SEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice