551662
ERCC2
Size
£843.00
- SKU:
- 551662
- Purity:
- Purified by affinity chromatography from cell culture.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-405 from human ERCC2, fused to GST-Tag. MW of the GST-Tag alone is 26kD.
- Clone:
- 4G2-2A6
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQR AYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGE KLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLT ASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIY NLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYL LDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNL TRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLV EGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAE HFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQR VCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANF ATLVSTYAKGQAQHCGSSRNQKRSHP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice