551659
EPCAM
Size
£685.00
- SKU:
- 551659
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa24-265 from human EPCAM, fused to His-Flag-StrepII-Tag.
- Clone:
- 7E19
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix. [provided by RefSeq]. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVIC SKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLY DPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDT EITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEIT TRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIAD VAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTL IYYVDEKAPEFSMQGLK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice