CUX1

Size

£843.00

SKU:: 551645
Purity:: Purified by affinity chromatography from cell culture.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa521-620 from human CUX1, fused to GST-Tag. MW of the GST-Tag alone is 26kD. Species sequence homology: rat
Clone:: 2A10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]. Applications: Suitable for use in ELISA, Immunofluorescence, Immunohistochemistry (paraffin), Immunoprecipitation, and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYP GRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKY LSLSPWDKATLSMGRLVLSNKMARTI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.