CTH

Size

£843.00

SKU:: 551644
Purity:: Purified by affinity chromatography from cell culture.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-405 from human CTH, fused to GST-Tag. MW of the GST-Tag alone is 26kD.
Clone:: 2E12-1C10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene. [provided by R. Dalgleish]. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRA VVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEK AVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDD VYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPET KLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFM SPYFQRPLALGADISMYSATKYMNGRSDVVMGLVSVN CESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVR MEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHEL VKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESL GGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGL EDEEDLLEDLDQALKAAHPPSGSHS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice