CFL1

Size

£843.00

SKU:: 551639
Purity:: Purified by affinity chromatography from cell culture.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-166 from human CFL1, fused to GST-Tag. MW of the GST-Tag alone is 26kD. Species sequence homology: mouse and rat
Clone:: 1A1
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM]. Applications: Suitable for use in ELISA, Immunofluorescence, Immunohistochemistry (paraffin), and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVL FCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLP DKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSK MIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKL GGSAVISLEGKPL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.