551619
B2M
Size
£843.00
- SKU:
- 551619
- Purity:
- Purified by affinity chromatography from cell culture.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-119 from human B2M, fused to GST-Tag. MW of the GST-Tag alone is 26kD.
- Clone:
- 3F9-2C2
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia]. Applications: Suitable for use in ELISA, Immunofluorescence, Immunohistochemistry, and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry: paraffin Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENG KSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSF SKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVK WDRDM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice