ANXA5

Size

£843.00

SKU:: 551612
Purity:: Purified by affinity chromatography from cell culture.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-320 from human ANXA5, fused to GST-Tag. MW of the GST-Tag alone is 26kD.
Clone:: 1F4-1A5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6kb and a protein product with a molecular weight of about 35kD. [provided by RefSeq]. Applications: Suitable for use in ELISA, Immunofluorescence, Western Blot, and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEE SILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTG KFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEII ASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQR MLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKW GTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDR ETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTD DHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDT SGDYKKALLLLCGEDD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice