531810
SRD5A1
Size
£583.00
- SKU:
- 531810
- Application:
- WB
- Purity:
- Purified by affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to a sequence within aa100-200 of human SRD5A1.
- Format:
- Supplied as a liquid in PBS, pH 7.3, 0.01% thimerosal, 50% glycerol.
- Extra Details:
- Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1:500-1:2000 Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice