Pterin-4-Alpha-Carbinolamine Dehydratase, Recombinant, Human, aa2-104, His-Tag (PCBD1)

Size

£431.00

SKU:: 518075
Molecular Weight:: 15.9
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH8.0, 50% glycerol
Extra Details:: nvolved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. Source: Recombinant protein corresponding to aa2-104 of human Pterin-4-Alpha-Carbinolamine Dehydratase, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.9kD Amino Acid Sequence: AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.