Alr2278 Protein, Recombinant, Nostoc sp., aa1-189, MBP-Tag, His-Tag (alr2278)

Size

£657.00

SKU:: 517800
Molecular Weight:: 65.2
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.
Extra Details:: Source: Recombinant protein corresponding to aa1-189 of Nostoc sp. Alr2278 Protein, fused to MBP-Tag at N-terminal and 6xHis-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~65.2kD Amino Acid Sequence: MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.