60S Ribosomal Protein L10, Recombinant, Drosophila Melanogaster, aa1-218, His-Tag (RpL10)

Size

£633.00

SKU:: 517782
Molecular Weight:: 29.5
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Extra Details:: Recombinant full length protein corresponding to aa1-218 of Drosophila Melanogaster 60S Ribosomal Protein L10, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Uniprot/Accession: O61231 Molecular Weight: ~29.5kD Amino Acid Sequence: MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.