Tumor Necrosis Factor Ligand Superfamily Member 4, Recombinant, Human, aa51-183, His-Tag (TNFSF4)

Size

£381.00

SKU:: 516821
Molecular Weight:: 16.3
Purity:: ≥95% (SDS-PAGE). Endotoxin: ≤1EU/ug (LAL).
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder in 20mM PBS, pH 7.4.
Extra Details:: Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. Partial recombinant protein corresponding to aa51-183 of human Tumor Necrosis Factor Ligand Superfamily Member 4, fused to 6X His-Tag at N-terminal, expressed in mammalian cell. Accession/Uniprot: P23510 Molecular Weight: ~16.3kD Biological Activity: The ED50 as determined by its ability to bind human OX40 in functional ELISA is less than 20ug/ml. Amino Acid Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O or PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.