Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A, Recombinant, Human, aa17-208, His-Tag (FCGR3A)

Size

£326.00

SKU:: 516813
Molecular Weight:: 22.61
Purity:: ≥95% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM PBS, pH 7.2. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Extra Details:: Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. Source: Recombinant protein corresponding to aa17-208 of human Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A, fused to His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~22.61kD Biological Activity: The ED50 as determined by its ability to bind human IGHG1 in functional ELISA is less than 20ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Shipping Conditions:: Blue Ice