493707
TEX14 (Inactive Serine/Threonine-Protein Kinase TEX14, Testis Expressed 14)
Size
£614.00
- SKU:
- 493707
- Application:
- WB
- Purity:
- Purified by affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region at the middle region: TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK of human TEX14.
- Format:
- Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose.
- Extra Details:
- TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. Applications: Suitable for use in and Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 0.2-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice