TAMM41 (Mitochondrial Translocator Assembly and Maintenance Protein 41 Homolog, TAM41, Mitochondrial Translocator Assembly and Maintenance Protein, Homolog (S. Cerevisiae))

Size

£599.00

SKU:: 493379
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: QSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDof N-terminal region of human TAMM41
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide
Extra Details:: C3orf31 may be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Applications: Suitable for use in Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 2.5ug/ml Immunohistochemistry: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.