PRNP (Major Prion Protein, Prion Protein)

Size

£614.00

SKU:: 489416
Purity:: Purified by affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF from the middle region of human PRNP. Species Sequence Homology: bovine, canine, goat, human, rat, sheep
Format:: Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose.
Extra Details:: Prnp may play a role in neuronal development and synaptic plasticity, may be required for neuronal myelin sheath maintenance and may play a role in iron uptake and iron homeostasis. Prnp is a soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. It also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Western Blot: 1ug/ml Immunohistochemistry (Paraffin): 1;100 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.