488977
POLQ (DNA Polymerase Theta, Polymerase (DNA Directed), Theta)
Size
£614.00
- SKU:
- 488977
- Application:
- WB
- Purity:
- Purified by affinity chromatography
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL from the C-terminal region of human POLQ .
- Format:
- Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose
- Extra Details:
- POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice