GPR65 (Psychosine Receptor, G Protein-Coupled Receptor 65)

Size

£614.00

SKU:: 482164
Application:: WB
Purity:: Purified by affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to human GPR65 located within the following region: LEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAVRHNKATENKEKKRII. Species sequence homology: canine: 77%; equine: 77%; mouse: 79%; porcine: 77%; rabbit: 79%; rat: 79%
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Extra Details:: GPR65 is a receptor for the glycosphingolipid psychosine (PSY) and several related glycosphingolipids. GPR65 may have a role in activation-induced cell death or differentiation of T-cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.