479826
E41L3 (Epb41l3 Dal1, Epb4.1l3, Kiaa0987)
Size
£614.00
- SKU:
- 479826
- Application:
- WB
- Purity:
- Purified by affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAA, of the N-terminal region of human E41L3.
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Extra Details:
- E41L3 is a tumor suppressor that inhibits cell proliferation and promotes apoptosis. It modulates the activity of protein arginine N- methyltransferases, including PRMT3 and PRMT5. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice