475787
ASTE1 (Protein Asteroid Homolog 1, Asteroid Homolog 1 (Drosophila))
Size
£614.00
- SKU:
- 475787
- Application:
- WB
- Purity:
- Purified by affinity chromatography
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS from mouse Aste1. Species Sequence Homology: canine, mouse and rat; 100%, guinea pig; 92%, human; 91%, equine; 90%
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Extra Details:
- Aste1 possible role in EGF receptor signaling Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 0.2-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice