470209
ZNF398 (KIAA1339, P51, P71, ZER6)
Size
£685.00
- SKU:
- 470209
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-642 from full length human ZNF398.
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Extra Details:
- This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQ TAAISLWTVVAAVQAIERKVEIHSRRLLHLEGRTGTAEK KLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRL ENLENLLRNRNFWILRLPPGIKGDIPKVPVAFDDVSIYF STPEWEKLEEWQKELYKNIMKGNYESLISMDYAINQP DVLSQIQPEGEHNTEDQAGPEESEIPTDPSEEPGISTS DILSWIKQEEEPQVGAPPESKESDVYKSTYADEELVIK AEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKSQQ STSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVG EQVFSCHHCGKNLSQDMLLTHQCSHATEHPLPCAQC PKHFTPQADLSSTSQDHASETPPTCPHCARTFTHPSR LTYHLRVHNSTERPFPCPDCPKRFADQARLTSHRRAH ASERPFRCAQCGRSFSLKISLLLHQRGHAQERPFSCP QCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRK EHLLNHRRLHTGERPFSCPHCGKSFIRKHHLMKHQRI HTGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGG DSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWY GEGSGGGVL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice