470192
TSFM (COXPD3, EF-TS, EF-Tsmt)
Size
£685.00
- SKU:
- 470192
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-346 from full length human TSFM
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Extra Details:
- Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes. The TSFM gene encodes a mitochondrial translation elongation factor (Smeitink et al., 2006 [PubMed 17033963]).[supplied by OMIM] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAG PRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGD LKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQ EGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMH CQTLKDQPSAYSKVQWLTPVNLALWEAEAGGSLEGF LNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKR AAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGAL VICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDE PGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFV RFECGEGEEAAETE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice