470188
TNFAIP6 (TSG-6, TSG6)
Size
£685.00
- SKU:
- 470188
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-277 from full length human TNFAIP6
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. The expression of this gene can be induced by tumor necrosis factor alpha and interleukin-1. The expression can also be induced by mechanical stimuli in vascular smooth muscle cells, and is found to be correlated with proteoglycan synthesis and aggregation. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYH REARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAARKI GFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYG IRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPGF PNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCL ADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTL KFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTST GNKNFLAGRFSHL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice