THOC3 (MGC5469, TEX1)

Size

£685.00

SKU:: 470181
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa 1-351 from full length human THOC3
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: TEX1 is part of the TREX (transcription/export) complex, which includes THO2 (MIM 300395), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).[supplied by OMIM] Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYV LGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLA SGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCW HPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENIN ICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFE VNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINA HPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCV RCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVET GDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKY DSSREAGTVKLFGLPNDS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.