TFAP2E (AP2E, MGC49007)

Size

£685.00

SKU:: 470178
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-434 from full length human TFAP2E.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAA TAAAEFQPPYFPPPYPQPPLPYGQAPDAAAAFPHLAG DPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLL APPARALGLDPRRDYATAVPRLLHGLADGAHGLADAP LGLPGLAAAPGLEDLQAMDEPGMSLLDQSVIKKVPIPS KASSLSALSLAKDSLVGGITNPGEVFCSVPGRLSLLSS TSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKN GGRCLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAV HLARDFGYVCETEFPAKAAAEYLCRQHADPGELHSRK SMLLAAKQICKEFADLMAQDRSPLGNSRPALILEPGVQ SCLTHFSLITHGFGGPAICAALTAFQNYLLESLKGLDKM FLSSVGSGHGETKASEKDAKHRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.