SQSTM1 (A170, OSIL, PDB3, ZIP3, p60, p62, p62B)

Size

£843.00

SKU:: 470171
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant full length protein corresponding to aa1-440 from human SQSTM1, fused to GST-Tag. MW of the GST tag alone is 26kD.
Clone:: 2C11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAA AGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLV AFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPC AQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYD LCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWL RKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPG PTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDI DVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPS KPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDN CSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSS LDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSM GFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice