470165
SNAP29 (CEDNIK, FLJ21051, SNAP-29)
Size
£685.00
- SKU:
- 470165
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-258 from full length human SNAP29
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGP DAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEK VGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHI NSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRL KEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSA MSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIAL GMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice