SFRS12 (DKFZp564B176, MGC133045, SRrp508, SRrp86)

Size

£685.00

SKU:: 470157
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-508 from full length human SFRS12.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).[supplied by OMIM] Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDP NIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTT TADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFAD QNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTP QAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKG GRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSHNRS RSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKR KDTREKIKEKERVKEKDREKEREREKEREKEKERGKN KDRDKEREKDREKDKEKDREREREKEHEKDRDKEKE KEQDKEKEREKDRSKEIDEKRKKDKKSRTPPRSYNAS RRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPS PRSRNKKDKKREKERDHISERRERERSTSMRKSSND RDGKEKLEKNSTSLKEKEHNKEPDSSVSKEVDDKDAP RTEENKIQHNGNCQLNEENLSTKTEAV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.