470152
SCN3B (HSA243396, SCNB3)
Size
£685.00
- SKU:
- 470152
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-215 from full length human SCN3B.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel beta subunit gene family, and influences the inactivation kinetics of the sodium channel. Two alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQG NPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIY EYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTL NDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAG EDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEEA AQENASDYLAIPSENKENSAVPVEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice