RRM2 (R2, RR2M)

Size

£685.00

SKU:: 470145
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-389 from full length human RRM2.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALS GTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLREN PRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQ HWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQE VQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKERE FLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAF AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDE GLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLT EALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRV ENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSSPTE NSFTLDADF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice