470143
RP11-35N6.1 (MGC26189, PRG-3)
Size
£685.00
- SKU:
- 470143
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-325 from full length human RP11-35N6.1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTD TFQVHIQGFFCQDGDLMKPYPGTEEESFITPLVLYCVL AATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLN PLLRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFL TVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRS FPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGT LCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGM CVVHNFKGTQGSPSKPKPEDPRGVPLMAFPRIESPLE TLSAQNHSASMTEVT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice