PVRIG (C7orf15, MGC104322, MGC138295, MGC138297, MGC2463)

Size

£685.00

SKU:: 470131
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length protein corresponding to aa1-326 from human PVRIG.
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MRTEAQVPALQPPEPGLEGAMGHRTLVLPWVLLTLCV TAGTPEVWVQVRMEATELSSFTIRCGFLGSGSISLVTV SWGGPDGAGGTTLAVLHPERGIRQWAPARQARWET QSSISLILEGSGASSPCANTTFCCKFASFPEGSWEACG SLPPSSDPGLSAPPTPAPILRADLAGILGVSGVLLFGCV YLLHLLRRHKHRPAPRLQPSRTSPQAPRARAWAPSQ ASQAALHVPYATINTSCRPATLDTAHPHGGPSWWASL PTHAAHRPQGPAAWASTPIPARGSFVSVENGLYAQA GERPPHTGPGLTLFPDPRGPRAMEGPLGVR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.