470125
PROM1 (AC133, CD133, MSTP061, PROML1, RP41)
Size
£685.00
- SKU:
- 470125
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-856 from full length human PROM1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELP ATNYETQDSHKAGPIGILFELVHIFLYVVQPRDFPEDTL RKFLQKAYESKIDYDKIVYYEAGIILCCVLGLLFIILMPLV GYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISL LVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRT LLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILD RLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQ QSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIR LSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLV QQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDN VTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSYW WLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRG CVSNTGGVFLMVGVGLSFLFCWILMIIVVLTFVFGANV EKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNK SKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNI NEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGI DRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPP GNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKIL QRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKY GRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDV FLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRR MDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNP VMTSPSQH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice