470123
PREP (MGC16060, PE, PEP)
Size
£685.00
- SKU:
- 470123
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-710 from full length human PREP
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Extra Details:
- The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately aa30 long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDS EQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYP KYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEA RVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASG SDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGK GMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQ SEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCD PVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVT NEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPE HEKDVLEWIACVRSNFLVLCYLHDVKNILQLHDLTTGA LLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHC DLTKEELEPRVFREVTVKGIDASDYQTVQIFYPSKDGT KIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVS RLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQ NCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAA CANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDY GCSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLL TADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVD TKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice