POU3F4 (BRAIN-4, BRN4, DFN3, DFNX2, OTF9)

Size

£685.00

SKU:: 470119
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-361 from full length human POU3F4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: his gene encodes a member of the POU-III class of neural transcription factors. This gene may play a role in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations have been associated with X chromosome-linked nonsyndromic mixed deafness. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKL LQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLAT SPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNH PNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLE HGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQD HSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLAL GTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLE EADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLET HFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQK EKRMTPPGDQQPHEVYSHTVKTDTSCHDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.