POLR3K (C11, C11-RNP3, My010, RPC10, RPC11, hRPC11)

Size

£685.00

SKU:: 470118
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-108 from full length human POLR3K
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRK VTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCE HPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.